La biotechnologie Cie., Ltd de Shenzhen Haiwen est une fabrication de poudre crue de stéroïdes, d'huiles demi-complètes, de liquide de finition, de HGH, de peptides et de DROGUES ANESTHÉSIQUES LOCALES en Chine.

Ventes & Support
Demande de soumission -
Select Language
Accueil
Produits
A propos de nous
Visite d'usine
Contrôle de la qualité
contacto
Demande de soumission
English
French
German
Italian
Russian
Spanish
Portuguese
Dutch
Greek
Japanese
Korean
Arabic
Hindi
Turkish
Indonesian
Vietnamese
Thai
Bengali
Persian
Polish
AccueilProduitsPoudre de croissance de cheveux

Lyophilisé injectez le polypeptide stéroïde de Sermorelin de croissance des cheveux 2mg/vial

J'ai reçu mes produits, vous emballage est faites discret et vous perfectionnez, il m'avez vraiment stupéfié que .i commandera plus de vous dès que possible. Tks !

—— Robet--Australia

J'ai coopéré avec vous pendant beaucoup de fois, votre qualité du produit est si grand, qu'est pourquoi j'achète toujours les produits de vous. merci

—— Richard---American

Salut le compagnon, votre meilleur prix et le produit de grande pureté est si concurrentiel dans mon pays, ceci m'ont laissé réaliser beaucoup de bénéfice, mes clients sont vraiment comme lui .tks

—— Johnson---Canada

Je suis en ligne une discussion en ligne

Lyophilisé injectez le polypeptide stéroïde de Sermorelin de croissance des cheveux 2mg/vial

Lyophilisé injectez le polypeptide stéroïde de Sermorelin de croissance des cheveux 2mg/vial fournisseur Lyophilisé injectez le polypeptide stéroïde de Sermorelin de croissance des cheveux 2mg/vial fournisseur

Image Grand :  Lyophilisé injectez le polypeptide stéroïde de Sermorelin de croissance des cheveux 2mg/vial

Détails sur le produit:

Lieu d'origine:La Chine
Nom de marque:SMQ
Certification:USP,SGS
Numéro de modèle:86168-78-7

Conditions de paiement et expédition:

Quantité de commande min:1 kg
Prix:USD 10g
Détails d'emballage:comme vous avez exigé
Délai de livraison:1-3 jour
Conditions de paiement:Western Union, Moneygram, T/T
Capacité d'approvisionnement:1000kg/week
Description de produit détaillée
Nom: Sermorelin Formule: C149H246N44O42S
Application: Tambour de peptide Apparence: poudre lyophilisée
Skype: nicole0918 Messagerie: 2355935183@ycphar.com

Lyophilisé injectez le polypeptide stéroïde de Sermorelin de croissance des cheveux 2mg/vial

 

 

Détail rapide :


Nom de produit : Sermorelin
Synonymes : SERMORELIN ; ACÉTATE DE SERMORELIN ; YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 ; TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 ; HUMAIN TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 ; H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 ; FACTEUR DE LIBÉRATION D'HORMONE DE CROISSANCE (1-29), AMIDE, HUMAINE ; AMIDE DE GRF (1-29) (HUMAINE)
CAS : 86168-78-7
MF : C149H246N44O42S
MW : 3357,88
Catégories de produit : Dérivés d'acide aminé ; Peptide ; Recherche GH-RHObesity ; GH-RHPeptides pour la biologie cellulaire ; Hormone de croissance sortant des facteurs ; Neuropeptides ; Neurotransmission (obésité) ; Sortir des facteurs
Utilisation : inhibiteur d'oxydase de xanthine

 
Processus d'emballage et de livraison :
 
1. La livraison : Des colis seraient arrangés d'ici 12 heures sur le reçu votre paiement.
2. Emballage : Des poudres de stéroïdes seraient emballées assez discrètement pour croiser des coutumes
3. dans le monde entier sans risque. Emballant comme la nourriture de chinois traditionnel, lavant et baignant des articles et d'autres équipements, etc….
4. Service supplémentaire : Des photos de du paquet seraient données pour vous pour indiquer à part les stéroïdes.
le nombre 5.Tracking serait offert une fois qu'il est libéré.
service 6.After-sale : Toutes les questions après que vous ayez obtenu le colis, svp nous contactent pour la première fois. Des problèmes seraient résolus pour vous immédiatement.
 
Avantage compétitif :
 

  1. Une expérience riche de charger une grande quantité de conteneurs dans le port maritime chinois ;
  2. Expédition rapide par la ligne maritime bien-réputée ;
  3. Emballage avec des palettes selon la demande spéciale des acheteurs ;
  4. Fourniture du meilleur service après expédition par l'email ;
  5. Cargaisons ainsi que le service de ventes de conteneur disponible ;
  6. Fourniture des photos des cargaisons avant et après le chargement dans le conteneur ;
  7. Matières premières d'origine chinoise ;

 

Produits connexes :

 

Série de polypeptide

 Nom de produit

Spécifications

MGF

2mg/vial

MGF DE CHEVILLE

2mg/vial

CJC-1295 avec DAC

2mg/vial

CJC-1295 sans DAC

2mg/vial

PT-141

10mg/vial

MT-1

10mg/vial

MT-2

10mg/vial

GHRP-2

10mg/vial

GHRP-2

5mg/vial

GHRP-6

10mg/vial

GHRP-6

5mg/vial

Ipamorelin

2mg/vial

Hexarelin

2mg/vial

Sermorelin

2mg/vial

Oxytocine

2mg/vial

 TB500

2mg/vial

pentadecapeptide BPC 157

2mg/vial

HGH 176-191

2mg/vial

Triptorelin2mg/vial
Tesamorelin2mg/vial
Gonadorelin2mg/vial
Gonadorelin10mg/vial
DSIP2mg/vial
Selank5mg/vial

 

 

 
 
Lyophilisé injectez le polypeptide stéroïde de Sermorelin de croissance des cheveux 2mg/vial

Coordonnées
Shenzhen Haiwen Biotechnology Co.,Ltd

Personne à contacter: Mrs. Lisa

Envoyez votre demande directement à nous (0 / 3000)

Autres Produits

99,5% poudre CAS pharmaceutique 38304-91-5 de croissance de cheveux de Minoxidil USP34 de grande pureté

Poudre de croissance de cheveux de BPH Avodart/Dutasteride 164656-23-9 Duagen

Lyophilisé injectez le polypeptide stéroïde de Sermorelin de croissance des cheveux 2mg/vial

Poudre orale CAS cristallin blanc 98319-26-7 de croissance de cheveux de Hongdenafil

Acétate PT141 CAS 32780-32-8 stéroïde de peptide de croissance aphrodisiaque de cheveux blancs

Stéroïdes d'Anti-oestrogène de Dutasteride Avodart de poudre de croissance de cheveux de la santé 99%

Stéroïdes stéroïdes d'Anti-oestrogène de Finasteride Proscar de croissance solide cristalline blanche de cheveux